SILu^TMLite SOST, Sclerostin human

NA.12

SILu^™Lite SOST is a recombinant human protein expressed in human 293 cells. It consists of 201 amino acids (including a N-terminal polyhistidine and tag), with a calculated molecular mass of 22.8 kDa. SILu^™Lite SOST is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Sclerostin is a secreted Wnt signaling antagonist produced almost exclusively by osteocytes. It can selectively inhibit Wnt/ β-catenin, suppressing the activity of osteoblasts as well as the viability of osteoblasts and osteocytes. Lower sclerostin levels are associated with lower bone mineral content and bone. It was demonstrated that greater total limb bone mineral content was significantly associated with greater circulating levels of sclerostin. In addition, circulating sclerostin is a biomarker of osteoporosis severity in long-term, chronic paraplegia. Serum sclerostin was associated significantly, independently, and positively with bone mineral density of both cortical and cancellous bone. Sclerostin is considered to be one of the factors associated with chronic kidney disease-mineral and bone disorder in hemodialysis patients.

HHHHHHHHGGQQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Supplied as a lyophilized powder containing phosphate buffered saline.

SILu is a trademark of sigma-aldrich Co. LLC

200

human

expressed in HEK 293 cells

8-His tagged

≥98% (SDS-PAGE)

lyophilized powder

mass spectrometry (MS): suitable

suitable for mass spectrometry (internal calibrator)

Q9BQB4

−20℃

human ... SOST(50964)

11 - Combustible Solids

WGK 2