Anti-ZRANB2 (ab1) antibody produced in rabbit

NA.41

Zinc finger ran-binding domain containing protein 2 (ZRANB2) is a part of supraspliceosome. It is present in the nucleus of human cells. This protein contains a C-terminal arginine/serine rich domain and two N-terminal RanBP2-type zinc fingers. ZRANB2 gene is located on human chromosome 1p31.1.

Synthetic peptide directed towards the N terminal region of human ZRANB2

ZRANB2 is a splice factor required for alternative splicing of SFRS10/TRA2B transcripts. It may interfere with constitutive 5′-splice site selection. Zinc finger Ran-binding domain containing protein 2 (ZRANB2) promotes differential splicing of numerous primary transcripts. Alternative splicing of transcripts might be associated with cancer. ZRANB2 is upregulated in grade III ovarian serous papillary carcinoma. The C-terminal interacts with spliceosomal proteins and the N- terminal helps in RNA recognition.

Synthetic peptide located within the following region: KTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESD

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

37 kDa

human, mouse, horse, bovine, rat, rabbit, dog, guinea pig

0.5 mg - 1 mg/mL

western blot: suitable

O95218

wet ice

−20℃

human ... ZRANB2(9406)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3