Anti-ZNF74 antibody produced in rabbit

HPA003354    Human Protein Atlas characterization data

ZNF74 (zinc finger protein 74) gene belongs to the transcription factor IIIA/Kruppel family and contains three exons. Exon 2 encodes an N-terminal truncated Kruppel-associated box (KRAB). Exon 3 encodes the zinc finger domain and the 3′-untranslated region (UTR). The protein encoded by this gene is approx. 64kDa and is localized to the nucleus. It is specifically expressed in neural crest-derived tissues and neuroepithelium of the spinal cord as well as in foregut endoderm epithelia (esophagus and respiratory tract).

Zinc finger protein 74 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

ZNF74 (zinc finger protein 74) gene encodes an RNA-binding protein that preferentially binds to poly(U) and poly(G) RNA homopolymers via the zinc finger domain. It is found associated with the nuclear matrix that is involved in the replication of DNA and in RNA synthesis and processing. The protein may be involved in RNA metabolism. Mutations in this gene are associated with DiGeorge syndrome (DGS), a developmental disorder.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73590.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

GEKPFDCSQCWKAFSCHSSLIVHQRIHTGEKPYKCSECGRAFSQNHCLIKHQKIHSGEKSFKCEKCGEMFNWSSHLTEHQRLHSEGKPLAIQFNKHLLSTYYVPGSLLGAGDAGLRDVDPIDALDVAKLLCVVP

Q16587

wet ice

−20℃

human ... ZNF74(7625)

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)