Anti-ZNF41 antibody produced in rabbit

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

89 kDa

rabbit, human, pig, horse, dog, rat, mouse, bovine

0.5 mg - 1 mg/mL

western blot: suitable

A8K1V6

wet ice

−20℃

human ... ZNF41(7592)

Synthetic peptide directed towards the C terminal region of human ZNF41

ZNF41 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF41 may be involved in transcriptional regulation. A chromosomal aberration, translocation t(X;7)(p11.3;q11.21), involving ZNF41 has been found in a patient with sever mental retardation. This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known.

Synthetic peptide located within the following region: LRVHQKIHTGEKPNICAECGKAFTDRSNLITHQKIHTREKPYECGDCGKT

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3