Anti-ZNF271 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human ZNF271

ZNF271 may be involved in transcriptional regulation. It plays a role in the EBV-mediated transformation process.Zinc finger proteins interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM]. Caspases are cysteine proteases that cleave C-terminal aspartic acid residues on their substrate molecules. This gene, CASP12, is most highly related to members of the ICE subfamily of caspases that process inflammatory cytokines. In rodents, the homolog of this gene mediates apoptosis in response to endoplasmic reticulum stress. However, in humans this gene contains a polymorphism for the presence or absence of a premature stop codon. The majority of human individuals have the premature stop codon and produce a truncated non-functional protein. The read-through codon occurs primarily in individuals of African descent and carriers have endotoxin hypo-responsiveness and an increased susceptibility to severe sepsis. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-360 AF464191.1 1-360 361-459 AP002004.4 93094-93192 c 460-967 AF464191.1 460-967 968-968 AP002004.4 86300-86300 c 969-1306 AF464191.1 969-1306

Synthetic peptide located within the following region: MCVGKPSVRAQILFCIRESILGRNHIHVISVAKVSVRIQTLLNIEGSTLE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

48 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

Q14591-2

wet ice

−20℃

human ... ZNF271(10778)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3