Anti-ZNF141 (ab2) antibody produced in rabbit

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

55 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

Q15928

wet ice

−20℃

human ... ZNF141(7700)

Synthetic peptide directed towards the middle region of human ZNF141

Zinc finger encoding genes would be good candidates for being involved in the multiple developmental defects associated with chromosomal aneusomy--because of their role as transcriptional regulators, their abundance in the genome and their known association with specific developmental disorders. A zinc finger encoding cDNA (ZNF141) of the C2-H2/KRAB subfamily has been mapped to the 4p- (Wolf-Hirschhorn) syndrome (WHS) chromosome region. ZNF141 was expressed ubiquitously at low levels in the analysed tissue. The identification of a candidate gene for a chromosomal aneusomy syndrome belonging to a class of evolutionary conserved genes will provide options for studying its normal and abnormal expression during mammalian embryogenesis.

Synthetic peptide located within the following region: KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIH

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3