Anti-ZFP95 antibody produced in rabbit

NA.41

ZFP95 is a zinc finger protein that contains 12 zinc-finger motifs at the C-terminus. The N-terminus of the protein has a SCAN box and a KRAB A domain. ZFP95 is a ubiquitously expressed protein, but has the strongest expression in testis.
Rabbit Anti-ZFP95 antibody recognizes mouse and human ZFP95.

Synthetic peptide directed towards the N terminal region of human ZFP95

Rabbit Anti-ZFP95 antibody can be used for western blot applications at a concentration of 1μg/ml.

ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.

Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

97 kDa

human, pig

0.5 mg - 1 mg/mL

western blot: suitable

NP_055384

Q9Y2L8

wet ice

−20℃

human ... ZFP95(23660)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3