Anti-TRMU antibody produced in rabbit

NA.41

TRMU codes for tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase that catalyzes the 2-thiolation of uridine. Studies have reported that TRMU mutations affect the deafness-associated mutations in 12S ribosomal RNA.
Rabbit Anti-TRMU antibody recognizes bovine, canine, human, mouse, and rat TRMU.

Synthetic peptide directed towards the C terminal region of human TRMU

Rabbit Anti-TRMU antibody is suitable for western blot applications at a concentration of 1μg/ml.

TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.

Synthetic peptide located within the following region: ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

48 kDa

rat, human, guinea pig, bovine, rabbit, mouse

0.5 mg - 1 mg/mL

western blot: suitable

NP_060476

O75648

wet ice

−20℃

human ... TRMU(55687)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3