Anti-TRIM33 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human TRIM33

TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

122 kDa

horse, mouse, dog, guinea pig, human, bovine, rabbit, rat

0.5 mg - 1 mg/mL

immunofluorescence: suitable
western blot: suitable

NM_015906

Q9UPN9

wet ice

−20℃

human ... TRIM33(51592)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3