Anti-TOMM70 antibody produced in rabbit

HPA014589    Human Protein Atlas characterization data

TOMM70A (translocase of outer mitochondrial membrane 70 homolog A) is a human ortholog of Tom70 protein found in yeast. This gene maps to human chromosome 3q13.1-q13.2, spans ~37kb, and consists of 12 exons. The encoded protein has a ubiquitous expression pattern in humans. It is a component of the mitochondrial TOM (translocase of outer membrane) complex, which also includes import pore complex and Tom20. It contains one TPR (tetratricopeptide repeat) clamp domain in its cytoplasmic region, and belongs to the TPR co-chaperone family.

translocase of outer mitochondrial membrane 70 recombinant protein epitope signature tag (PrEST)

Anti-TOMM70A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

TOMM70A (translocase of outer mitochondrial membrane 70 homolog A) forms a part of the mitochondrial TOM (translocase of outer membrane) complex, where it prefers preproteins with internal targeting sequences which are hydrophobic in nature. The TPR (tetratricopeptide repeat) domain of this protein docks the C-termius EEVD motifs of Hsp70 and Hsp90 chaperone proteins, and forms a multi-chaperone complex which binds to preproteins, and prevents their aggregation. The expression of this protein is induced by non-structural protein (NS) 3 protein of hepatitis C virus (HCV). TOMM70A is therefore, associated with the apoptotic response to HCV. It interacts with IRF3 protein, and causes apoptosis in the presence of Sendai virus. It also acts as an import receptor for PTEN induced kinase 1 (PINK1), a gene associated with Parkinson′s disease (PD).

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72919.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human, mouse

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT

wet ice

−20℃

human ... TOMM70A(9868)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)