ANTI-TEK antibody produced in mouse

NA.41

The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase. (provided by RefSeq)

TEK (AAH35514, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND

Solution in phosphate buffered saline, pH 7.4

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2D2, monoclonal

buffered aqueous solution

antigen 36.41 kDa

human

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2aκ

BC035514

Q02763

dry ice

−20℃

human ... TEK(7010)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids