Anti-TCERG1 (ab2) antibody produced in rabbit

MFCD02097839

NA.41

Synthetic peptide directed towards the N terminal region of human TCERG1

TCERG1 is a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. TCERG1 interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. This gene encodes a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. The encoded protein interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. Alternative splicing results in multiple transcripts variants encoding different isoforms.

Synthetic peptide located within the following region: AERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPP

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

124 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

O14776

wet ice

−20℃

human ... TCERG1(10915)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3