Anti-SYVN1 antibody produced in rabbit

HPA005480    Human Protein Atlas characterization data

Synovial apoptosis inhibitor 1/ synoviolin (SYVN1) is a part of ER-associated degradation (ERAD) and is an E3 ubiquitin ligase. It localizes to endoplasmic reticulum (ER) and is ubiquitously expressed. It is highly expressed in skeletal muscle, pancreas and liver. SYVN1 contains six domains, which span the plasma membrane. It is a non-glycosylated protein and has a cytoplasmic RING-H2 finger domain. This gene is located on chromosome 11q13.

E3 ubiquitin-protein ligase synoviolin precursor recombinant protein epitope signature tag (PrEST)

Anti-SYVN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Synovial apoptosis inhibitor 1/ synoviolin (SYVN1) plays a key role in various processes, such as embryogenesis or negative regulation of tumor suppressor gene p53. The expression of SYVN1 is induced by IRE1 and ATF6, during ER stress, where it protects against ER-stress induced cell apoptosis. It is a part of endoplasmic reticulum associated degradation (ERAD) and degrades 3-hydroxy-3-methylglutaryl-coenzyme A, along with TCR-α and CD3-δ, which are ERAD substrates. It also sequesters p53, in the cytoplasm, and ubiquitinates it. Thus, it represses the various activities of p53, such as cell cycle regulation and apoptosis. SYVN1 is responsible for maintaining joint homeostasis and hence, is involved in the pathogenesis of arthropathy. In rheumatoid arthritis, it is overexpressed in synovial cells, leading to a ′hyper-ERAD′ state. It interacts with, and degrades tau and phosphorylated tau (p-tau). Therefore, it prevents tau-induced cytotoxicity and helps neuronal survival.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70751.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT

Q86TM6

wet ice

−20℃

human ... SYVN1(84447)

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)