Anti-SSB antibody produced in rabbit

NA.41

Sjogren syndrome antigen B (autoantigen La) (SSB/La) is a small nuclear RNA binding protein involved in autoimmune response in diseases such as Sjögren′s syndrome, systemic lupus erythematosus (SLE), progressive systemic sclerosis (PSS), polymyositis-dermatomyositis (PM-DM), and rheumatoid arthritis (RA).

Anti-SSB polyclonal antibody reacts with human, mouse, rat, bovine, and canine Sjogren syndrome antigen B (autoantigen La) proteins.

Synthetic peptide directed towards the N terminal region of human SSB

Anti-SSB polyclonal antibody is used to tag Sjogren syndrome antigen B for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of Sjogren syndrome antigen B in autoimmune diseases.

SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.La is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III (see MIM 606007)-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. La protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome (MIM 270150) and systemic lupus erythematosus (SLE; MIM 152700) (Teplova et al., 2006).[supplied by OMIM].

Synthetic peptide located within the following region: ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

45 kDa

bovine, dog, human, guinea pig, horse, mouse, rabbit, rat

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_003133

P05455

wet ice

−20℃

human ... SSB(6741)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3