Anti-SLC22A6 (ab2) antibody produced in rabbit

NA.41

Solute carrier family 22 member 6 (SLC22A6) belongs to organic anion transporter-1 family. The protein is expressed in kidney and brain. The gene is located on human chromosome 11q12.3.

Synthetic peptide directed towards the N terminal region of human SLC22A6

Solute carrier family 22 member 6 (SLC22A6) is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
SLC22A6 regulates the body disposition of a variety of clinically important drugs, such as, anti-HIV therapeutics, antitumor drugs, antibiotics, antihypertensives and anti-inflammatories. Ubiquitination sites of SLC22A6 is involved in the protein kinase C (PKC)-mediated endocytosis of the transporter. It plays an important role in substrate recognition.

Synthetic peptide located within the following region: AFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRP

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

62 kDa

bovine, mouse, dog, rabbit, human, horse, rat, guinea pig

0.5 mg - 1 mg/mL

western blot: suitable

Q4U2R8

wet ice

−20℃

human ... SLC22A6(9356)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3