Anti-RGS8 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human RGS8

RGS8 is a member of the regulator of G protein signaling (RGS) family and is a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. They accelerate transit through the cycle of GTP binding and hydrolysis to GDP, thereby terminating signal transduction, but paradoxically, also accelerate receptor-stimulated activation.This gene is a member of the regulator of G protein signaling (RGS) family and encodes a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. They accelerate transit through the cycle of GTP binding and hydrolysis to GDP, thereby terminating signal transduction, but paradoxically, also accelerate receptor-stimulated activation.

Synthetic peptide located within the following region: NKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDV

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

22 kDa

bovine, horse, mouse, dog, guinea pig, human, rat

0.5 mg - 1 mg/mL

western blot: suitable

NP_001095920

P57771

wet ice

−20℃

human ... RGS8(85397)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3