Anti-RCV1 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the C terminal region of human RCV1

RCV1 is a member of the recoverin family of neuronal calcium sensors. RCV1 contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.The protein encoded by this gene contains four calcium-binding EF-hand domains and belongs to the recoverin family of neuronal calcium sensors. Recoverin may prolong the termination of the phototransduction cascade by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy; an autoimmune disease of the retina caused by a tumor in another tissue.

Synthetic peptide located within the following region: KMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

23 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_002894

Q53XL0

wet ice

−20℃

human ... RCV1(5957)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 2