Anti-PTF1A, (N-terminal) antibody produced in rabbit

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

35 kDa

horse, human, bovine, pig

0.5 mg - 1 mg/mL

western blot: suitable

NM_178161

Q7RTS3

wet ice

−20℃

human ... PTF1A(256297)

Synthetic peptide directed towards the N terminal region of human PTF1A

PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas. This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3