Anti-PTCH2 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human PTCH2

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)

PTCH2 is a member of the patched protein family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. The gene encoding PTCH2 is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors. This gene encodes a member of the patched gene family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. This gene is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors. Alternative transcript variants have been described, but their biological function has not been determined. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 AF119569.1 1-10 11-534 AY359016.1 3-526 535-2066 AF087651.1 523-2054 2067-2509 AF119569.1 2067-2509 2510-2520 AF087651.1 2498-2508 2521-2700 AF119569.1 2521-2700 2701-3620 AY358555.1 2689-3608 3621-3624 AF087651.1 3609-3612

Synthetic peptide located within the following region: LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

130 kDa

bovine, human, dog, horse

0.5 mg - 1 mg/mL

western blot: suitable

Q9Y6C5

wet ice

−20℃

human ... PTCH2(8643)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3