Anti-PSMD8 antibody produced in rabbit

NA.41

PSMD8 codes for a non-ATPase proteasome subunit. It is known to increase polyspermy during porcine fertilization in in vitro conditions.
Rabbit Anti-PSMD8 antibody recognizes bovine, human, mouse, rat, and canine PSMD8.

Synthetic peptide directed towards the C terminal region of human PSMD8

Rabbit Anti-PSMD8 antibody is suitable for western blot applications at a concentration of 1μg/ml.

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. PSMD8 is a non-ATPase subunit of the 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Synthetic peptide located within the following region: DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

27 kDa

horse, human, rat, guinea pig, bovine, dog, mouse, rabbit

0.5 mg - 1 mg/mL

western blot: suitable

NP_002803

P48556

wet ice

−20℃

human ... PSMD8(5714)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3