Anti-PSMD11 (AB1) antibody produced in rabbit

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

47 kDa

human, mouse, guinea pig, bovine, rat, dog, yeast, horse, rabbit

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_002806

O00231

wet ice

−20℃

human ... PSMD11(5717)

Proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 (PSMD11) is a non-ATPase subunit of the 19S regulator complex which together with the 20S core complex make up the multicatalytic proteinase complex know as the 26S proteosome.

Rabbit polyclonal anti-PSMD11 (AB1) antibody reacts with bovine, canine, zebrafish, zebrafish, human, mouse, and rat 26S proteasome non-ATPase regulatory subunit 11 subunits.

Synthetic peptide directed towards the C terminal region of human PSMD11

Rabbit polyclonal anti-PSMD11 (AB1) antibody is used to tag 26S proteasome non-ATPase regulatory subunit for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of 26S proteasome non-ATPase regulatory subunit in the structure and function of the 19S regulator complex of the 26S proteosome.

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator.

Synthetic peptide located within the following region: ALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAK

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3