Anti-PSG9 antibody produced in rabbit

NA.41

Pregnancy-specific β 1-glycoproteins (PSGs), related to the carcinoembryonic antigen family, are major placental polypeptides. Pregnancy specific β-1-glycoprotein 9 (PSG9, PSGII) is found in placenta and sera of pregnant woman and in some cancers. PSG9 may be a useful biomarker for early detection of colorectal cancer.

Synthetic peptide directed towards the N terminal region of human PSG9

Anti-PSG9 polypeptide antibody is used to tag pregnancy specific β-1-glycoprotein 9 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of pregnancy specific β-1-glycoprotein 9 in placenta development and as a possible early biomarker of colorectal cancer.

Synthetic peptide located within the following region: YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

54 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_002775

Q00887

wet ice

−20℃

human ... PSG9(5678)

Anti-PSG9 polypeptide antibody reacts with human β-1-glycoprotein 9.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3