Anti-PRPF4 antibody produced in rabbit

HPA022248    Human Protein Atlas characterization data

PRPF4 (Pre-mRNA processing factor 4) encodes a 60kDa protein (hPrp4) consisting of 522 amino acids with seven WD40 repeats at its C-terminal end. It is a member of the Ser/Thr protein kinase family and is mapped on chromosome 9q32. It is widely expressed in human tissues and in murine neuronal cells (neural retina and retinal pigmented epithelium cells).

U4/U6 small nuclear ribonucleoprotein Prp4 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

PRPF4 (Pre-mRNA processing factor 4) is a spliceosomal protein highly involved in the pre-mRNA splicing. It acts as a component of U4/U5/U6 tri-snRNP complex during the formation of active core of the spliceosome. Mutation in PRPF4 causes an autosomal dominant disorder, retinitis pigmentosa (RP) characterized with progressive loss of photoreceptors. PRPF4 is important in cell mitosis and is involved in the regulation of mitotic spindle assembly.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST75265.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

mouse, rat, human

antibody small pack of 25 μL

independent
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

ISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIE

O43172

wet ice

−20℃

human ... PRPF4(9128)

10 - Combustible liquids

WGK 1