Anti-PRDX6 (AB2) antibody produced in rabbit

NA.41

Peroxiredoxin 6 (PRDX6) is a thiol-specific antioxidant protein that acts as a bifunctional enzyme. It is involved in modulating the susceptibility of β cells to oxidative stress. Prdx6 deficiency has been linked to impaired homeostasis and cell death/apoptosis. It has also been implicated in papillary thyroid carcinomas.
Rabbit Anti-PRDX6 antibody recognizes pig, bovine, human, mouse, rat, chicken, and zebrafish PRDX6.

Synthetic peptide directed towards the middle region of human PRDX6

Rabbit Anti-PRDX6 antibody has been used for immunoblot applications at a dilution of 1:1000.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

25 kDa

dog, bovine, horse, rabbit, guinea pig, sheep, rat, human, mouse

0.5 mg - 1 mg/mL

western blot: suitable

NP_004896

P30041

wet ice

−20℃

human ... PRDX6(9588)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3