Anti-PHF20L1 antibody produced in mouse

NA.41

The gene PHF20L1 (PHD finger protein 20-like 1) is mapped to human chromosome 8q24.22. The protein has a MBT (malignant brain tumor) domain and tudor domain.

PHF20L1 (NP_940915.1, 1 a.a. ~ 285 a.a) full-length human protein.

Sequence
MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYWDSNRLRPLERPALRKEGLKDEEDFFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMPEDAKGQDWIALVKAAAAAAAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNKITGLLASKAVGVDGAEKKEDYNETAPMLEQV

PHF20L1 (PHD finger protein 20-like 1) interacts with monomethylated lysine 142 on DNMT1 (DNA methyltransferase 1). It helps chromatin loading of DNMT1 and also protects it from proteasomal degradation. PHF20L1 might play a crucial role in epigenetic inheritance. The gene is overexpressed in breast cancer and is linked with shorter survival of patients. Absence of PHF20L1 activity suppresses cell proliferation in breast cancer cell lines.

Solution in phosphate buffered saline, pH 7.4

100

mouse

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

human

indirect immunofluorescence: suitable
western blot: 1 μg/mL

A8MW92

dry ice

−20℃

human ... PHF20L1(51105)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids