Anti-PHB2 (AB2) antibody produced in rabbit

NA.41

PHB2 codes for prohibitin 2 that protects the cohesion of sister chromatids during mitosis. PHB2 downregulation has been linked to anorexia-induced fission and apoptosis in mitochondria.
Rabbit Anti-PHB2 antibody recognizes bovine, chicken, human, mouse, rat, and canine PHB2.

Synthetic peptide directed towards the N terminal region of human PHB2

Rabbit Anti-PHB2 (AB2) antibody is suitable for western blot applications at a concentration of 1μg/ml.

PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.

Synthetic peptide located within the following region: WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

33 kDa

horse, mouse, rabbit, rat, bovine, human, dog, guinea pig

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001138303

Q99623

wet ice

−20℃

human ... PHB2(11331)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3