Anti-PCDH8 (ab2) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human PCDH8

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails.

Synthetic peptide located within the following region: GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

101 kDa

rat, human, dog, bovine, guinea pig, rabbit, mouse

0.5 mg - 1 mg/mL

western blot: suitable

Q5TAN1

wet ice

−20℃

human ... PCDH8(5100)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3