Anti-PBX2 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the C terminal region of human PBX2

PBX2 is a ubiquitously expressed member of the TALE/PBX homeobox family. PBX2 gene was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. PBX2 is a transcriptional activator which binds to the TLX1 promoter. This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6.

Synthetic peptide located within the following region: PGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

46 kDa

dog, mouse, human, rat, bovine, guinea pig, horse, rabbit

0.5 mg - 1 mg/mL

western blot: suitable

NP_002577

P40425

wet ice

−20℃

human ... PBX2(5089)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1