Anti-MFNG (AB1) antibody produced in rabbit

NA.41

MFNG codes for a secretory protein that plays a role in Notch signaling during embryonic development. This secretory protein exhibits fucose-specific β-1,3-N-acetylglucosaminyltransferase functions which can lead to the elongation of O-linked fucose residues in Notch.
Rabbit Anti-MFNG antibody recognizes bovine, human, mouse, rat, and canine MFNG.

Synthetic peptide directed towards the middle region of human MFNG

Rabbit Anti-MFNG antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

36 kDa

horse, rabbit, human, mouse, rat

0.5 mg - 1 mg/mL

western blot: suitable

NP_002396

O00587

wet ice

−20℃

human ... MFNG(4242)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3