ANTI-MCM3 antibody produced in mouse

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2H3, monoclonal

buffered aqueous solution

antigen 37.84 kDa

human

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_002388

P25205

dry ice

−20℃

human ... MCM3(4172)

Minichromosome maintenance complex component 3 (MCM3) is encoded by the gene mapped to human chromosome 6p12.2-p12.1. The encoded protein is a member of MCM protein family.
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. (provided by RefSeq)

MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI

Minichromosome maintenance complex component 3 (MCM3) is a mini-chromosome maintenance protein in eukaryotic genome replication. MCM proteins are key components of the pre-replication complex, recruit replication-related proteins and form replication forks. The PS1 putative hairpin of MCM3 is specifically required for DNA unwinding and viability. MCM3 is a marker for tumorigenesis in several human cancers. Aberration in the expression of MCM3 is associated with the development of papillary thyroid carcinoma (PTC).

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids