Anti-MAP3K7IP2 antibody produced in rabbit

NA.41

Mitogen-activated protein kinase kinase kinase 7-interacting protein 2/TGF-β activated kinase 1 (MAP3K7IP2, TAB2) is an activator of MAP3K7/TAK1 required for the IL-1 induced activation of nuclear factor kappaB and MAPK8/JNK. MAP3K7IP2, together with TAB1 and MAP3K7 supports the signal transduction of TNFSF11/RANKL. MAP3K7IP2/TAB2 mediates polyubiquitin chain-dependent TAK1 activation in innate immune signaling pathways.
Rabbit polyclonal anti-MAP3K7IP2 antibody reacts with bovine, chicken, human, mouse, rat, and canine mitogen-activated protein kinase kinase kinase 7-interacting protein 2/TGF-β activated kinase 1 factors.
Variations in MAP3K7IP2 have been linked to Grave′s disease.

Synthetic peptide directed towards the N terminal region of human MAP3K7IP2

Rabbit Anti-MAP3K7IP2 antibody can be used for western blot applications at a concentration of 2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissue sections.
Rabbit polyclonal anti-MAP3K7IP2 antibody is used to tag mitogen-activated protein kinase kinase kinase 7-interacting protein 2/TGF-β activated kinase 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of mitogen-activated protein kinase kinase kinase 7-interacting protein 2/TGF-β activated kinase 1 in the activation of the MAP3K7/TAK1 pathway and nuclear factor kappaB (NFkB) signaling.

MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.

Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

76 kDa

human, mouse, horse, guinea pig, rabbit, dog, rat, bovine

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_055908

Q9NYJ8

wet ice

−20℃

human ... MAP3K7IP2(23118)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3