Anti-LCMT2 antibody produced in rabbit

NA.41

LCMT2 codes for leucine carboxyl methyltransferase 2 that belongs to the variable methyltransferase superfamily.
Rabbit anti-LCMT2 antibody recognizes canine, human, and chicken LCMT2.

Synthetic peptide directed towards the C terminal region of human LCMT2

Rabbit anti-LCMT2 antibody is suitable for western blot applications at a concentration 1μg/ml.

LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW). The protein encoded by this intronless gene belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).

Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

75 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_055608

O60294

wet ice

−20℃

human ... LCMT2(9836)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3