Anti-INHBE antibody produced in rabbit

rabbit

100

unconjugated

purified immunoglobulin

primary antibodies

polyclonal

buffered aqueous solution

mouse, human

immunoprecipitation (IP): suitable
western blot: 1 μg/mL

NM_031479

P58166

dry ice

−20℃

human ... INHBE(83729)

Inhibin subunit beta E (INHBE) is a dimeric protein, which is majorly expressed in human liver. The gene is located on human chromosome 12q13.3.

INHBE (NP_113667.1, 1 a.a. ~ 350 a.a) full-length human protein.

Sequence
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Inhibin subunit beta E (INHBE) may be associated with carcinogenesis. Differential expression of INHBE in human endometrial tissue plays an important role in endometrial maturation and blastocyst implantation. The protein is a hepatokine linked to hepatic gene expression. It is associated with insulin resistance and body mass index in humans. The protein expression in liver is stimulated by insulin. It is involved in glucose metabolism.

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids