Anti-ILF3 (AB3) antibody produced in rabbit

NA.41

Interleukin enhancer binding factor 3, 90 kDa (ILF3) is an isoform of the double-RNA binding protein (DRBP) family that interacts with the stem-loop structure of specific mRNAs such as VEGF mRNa and Tau mRNA to improve stability and targeting. ILF3, which promotes the stability anti-apoptotic agent survivin in cancers, is a direct target of γM155, a survivin suppressor.

Anti-ILF3 (AB3) polyclonal antibody reacts with bovine and human interleukin enhancer binding factor 3, 90 kDa proteins.

Synthetic peptide directed towards the N terminal region of human ILF3

Anti-ILF3 (AB3) polyclonal antibody is used to tag interleukin enhancer binding factor 3, 90 kDa protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of interleukin enhancer binding factor 3, 90 kDa in major cell processes such as survival through binding and stabilization of key mRNAs.

ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity. ILF3 may regulate transcription of the IL2 gene during T-cell activation. It can promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.

Synthetic peptide located within the following region: PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

76 kDa

guinea pig, human

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_060090

Q12906-2

wet ice

−20℃

human ... ILF3(3609)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3