Anti-IL9 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human IL9

Anti-IL9 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Interleukin-9 (IL-9) is a pleotropic cytokine produced by activated T cells and also by mast cells in response to LPS and IL-1. The biological effects of IL-9 are mediated by IL-9 receptor (IL-9R) that is made up of an α and a γ chain. The expression of IL-9R is restricted to effector T cells, mast cells and few non-hematopoietic cells. IL-9R signalling results in the activation of major signalling pathways involving STAT1, -3 and -5, MAPK, PI3K and IRS. IL-9R signalling is pro-inflammatory and promotes allergic inflammation and airway remodelling in lungs. It is also important in cell growth and differentiation of T cells, B cells, mast cells, hematopoietic progenitors, epithelial cells and airway smooth muscle cells.

Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

14 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_000581

P15248

wet ice

−20℃

human ... IL9(3578)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3