Anti-HTR1F antibody produced in rabbit

HPA005555    Human Protein Atlas characterization data

HTR1F (5-hydroxytryptamine (serotonin) receptor 1F) belongs to the 5-HT_1-like receptor family, which in turns forms one of the four classes of serotonin receptor. The 5-HT_1-like receptor family has five members, namely, 5-HT_1A, 5-HT_Dα, 5-HT_1Dβ or 5-HT_1B, 5-HT_1E and HTR1F. HTR1F is expressed in vascular as well as neuronal tissues. This gene is localized to human chromosome 3p12. The protein is expressed in brain, mesentery and uterus. In brain, HTRF1 is expressed in V pyramidal neurons in the neocortex, pyramidal cells in hippocampus, dorsal raphe and multiple thalamic nuclei.

5-hydroxytryptamine receptor 1F recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

HTR1F (5-hydroxytryptamine (serotonin) receptor 1F) is a receptor to serotonin, and in response to serotonin binding, inhibits adenylate cyclase. It has high affinity for anti-migraine drugs ergotamine and sumatriptan. Therefore, it might play a role in the anti-migraine activity of these drugs. This receptor might play a role in the coordination of limbic functions by regulating the integration of afferent and sensorimotor information. Its presence in dorsal raphe indicates that, HTRF1 might act as an autoreceptor.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70064.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:20- 1:50

AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS

P30939

wet ice

−20℃

human ... HTR1F(3355)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)