Anti-GZMK antibody produced in rabbit

NA.41

Granzyme K (GZMK) also known as tryptase 2 (TRYP2), is a trypsin like serine protease, evolutionarily similar to granzyme A (GZMA). In human chromosome, the gene GZMK is localized on 5q11.2.

Synthetic peptide directed towards the middle region of human GZMK

GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes and natural killer cells. GZMK cleave after the basic amino acids like arginine or lysine. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface ′nonself′ antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. Gmzk expression level is higher in patients with sepsis and also in bronchoalveolar fluid with respiratory infections. GzmK can cause apoptosis by DNA fragmentation, and also by ROS (reactive oxygen species) production. GzmK triggers cleavage of p53, a proapoptotic protein and that potentiates apoptosis of tumor cells. Gzmk is highly expressed in NK cells and plays a key role in NK cells mediated tumor cell clearance. β-tubulin, a component of microtubule network is cleaved by Gzmk, which is crucial for maintaining the cell shape, mitosis and the intracellular trafficking.

Synthetic peptide located within the following region: LRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPF

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

26 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NM_002104

P49863

wet ice

−20℃

human ... GZMK(3003)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3