Anti-GCNT2 antibody produced in rabbit

HPA026776    Human Protein Atlas characterization data

Glucosaminyl (N-acetyl) transferase 2 (GCNT2) protein is encoded by the novel metastasis-related gene mapped to human chromosome 6p24. The GCNT2 protein belongs to the β-1, 6-N-acetylglucosaminyltransferase family, which has an essential role in glycosylation.

N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Glucosaminyl (N-acetyl) transferase 2 (GCNT2) is an enzyme essential for the development of the blood group I antigen. Biallelic mutation of GCNT2 leads to autosomal recessive congenital cataracts and the rare adult i blood group. GCNT2 associates with β1,3-N-acetylglucosminyltransferase 2(β3GnT2) to regulate the PLN levels in olfactory neurons by modulating β1, 6-branches that aids in Poly-N-acetyllactosamine (PLN) extension. Over human developmental stage, GCNT2 enzyme transforms linear i-antigen to I-branching glycan by replacing GlcNAc of uridine diphosphate–GlcNAc with galactose β1-6 linkage of linear lactosamine chains. Uprooted expression of GCNT2 enzyme increases cell detachment, cell adhesion, cell migration and invasion in vitro, and lung metastasis of breast cancer cells in vivo. Overexpression of GCNT2 contributes to breast cancer metastasis. Transforming growth factor-β1 (TGF-β1) acts as an effector of GCNT2 enzyme and plays a major role in TGF-β1induced epithelial-to-mesenchymal transition (EMT).

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71799.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT

Q8N0V5

wet ice

−20℃

human ... GCNT2(2651)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1