Anti-fxr1 antibody produced in rabbit

HPA018246    Human Protein Atlas characterization data

The gene FXR1 (fragile X mental retardation syndrome-related protein 1) is mapped to human chromosome 3q28. FXR1 belongs to fragile X related family. It is an autosomal paralog of fragile X mental retardation 1. FXR1 is a RNA binding protein and is localized in the cytoplasm. RT-PCR analysis showed FXR1 expression in brain, heart, kidney and testis.

Fragile X mental retardation syndrome-related protein 1 recombinant protein epitope signature tag (PrEST)

Anti-FXR1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Fragile X mental retardation syndrome-related protein 1 (FXR1) plays an important role in development as FXR1 knockout mice die early during embryogenesis. FXR1 is important for proper development of the muscle tissue. Facioscapulohumeral muscular dystrophy myoblasts show abnormal expression of FXR1 which deregulates the proper metabolism of muscle specific mRNAs. Similarly, miR369-3 mediated association of argonaute 2 and FXR1 with AU-rich elements directs translational activation. FXR1 forms a complex with oncogenes, protein kinase C, iota and epithelial cell transforming-2, resulting in tumor progression and non-small cell lung cancer growth. Binding of plakophilins 1/3 with FXR1 is important for stability of specific mRNAs. FXR1 also interacts with tudor domain-containing protein-3 and Bcl-2-associated transcription factor-1. Glycogen synthase kinase 3β phosphorylates and down-regulates FXR1, thereby regulating behavior dimensions related to mood disorders in humans.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74180.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

rat, human, mouse

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL

P51114

wet ice

−20℃

human ... FXR1(8087)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)