Anti-FXN antibody produced in rabbit

NA.41

Synthetic peptide directed towards the C terminal of human FXN

Fxn promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. It may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. It may be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Fxn modulates the RNA-binding activity of ACO1.

Synthetic peptide located within the following region: EFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

23 kDa

horse, guinea pig, bovine, dog, rat, mouse, human, rabbit

0.5 mg - 1 mg/mL

western blot: suitable

NM_001191952

D3ZYW7

wet ice

−20℃

human ... FXN(2395)
rat ... Fxn(499335)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3