Anti-FUT6 antibody produced in rabbit

NA.41

Fucosyltransferase 6 (alpha (1,3) fucosyltransferase) (FUT6) codes for a Golgi stack membrane protein that is involved in sialyl-Lewis X, formation. Studies have reported that FUT6 expression is induced during HSV-1 infection.
Rabbit Anti-FUT6 antibody recognizes chicken, mouse, rat, canine, zebrafish, bovine, and human FUT6.

Synthetic peptide directed towards the C terminal region of human FUT6

Rabbit Anti-FUT6 antibody is suitable for western blot applications at a concentration of 1μg/ml.

FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.

Synthetic peptide located within the following region: YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

42 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_001035791

P51993

wet ice

−20℃

human ... FUT6(2528)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3