Anti-FOXP1 antibody produced in rabbit

NA.41

FOXP1 is a transcription regulator that is expressed in B cells. High levels of FOXP1 expression have been associated with poor prognosis in patients with diffuse large B-cell lymphomas (DLBCLs). Chromosomal aberrations in FOXP1 gene have been linked to mucosa-associated lymphoid tissue (MALT) lymphoma.
Rabbit Anti-FOXP1 antibody recognizes bovine, canine, chicken, human, mouse, and rat FOXP1.

Synthetic peptide directed towards the N terminal region of human FOXP1

Rabbit Anti-FOXP1 antibody can be used for IHC (4-8μg/ml) and western blotting (0.5μg/ml) applications.

FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).

Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

75 kDa

horse, rabbit, guinea pig, human, mouse, rat

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_116071

Q9H334

wet ice

−20℃

human ... FOXP1(27086)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3