Anti-FOXI1 (ab2) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human FOXI1

FOXI1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXI1 may plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis.This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene.

Synthetic peptide located within the following region: MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

41 kDa

rabbit, bovine, mouse, rat, guinea pig, human

0.5 mg - 1 mg/mL

western blot: suitable

Q12951

wet ice

−20℃

human ... FOXI1(2299)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3