Anti-Fmr1 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the C terminal of human FMR1

Fmr1 is a translation repressor. Fmr1 is a component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates translation repression. RNA-binding protein that plays a role in intracellular RNA transport and in the regulation of translation of target mRNAs.Fmr1 is associated with polysomes. Fmr1 is involved in the transport of mRNA from the nucleus to the cytoplasm. Fmr1 binds strongly to poly(G), binds moderately to poly(U) but shows very little binding to poly(A) or poly(C).

Synthetic peptide located within the following region: QIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRGHGRRGPGYTSES

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

67 kDa

rat, bovine, rabbit, dog, human, mouse, guinea pig

0.5 mg - 1 mg/mL

western blot: suitable

NM_052804

Q80WE1

wet ice

−20℃

human ... FMR1(2332)
rat ... Fmr1(24948)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3