Anti-FEM1B (AB1) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human FEM1B

Anti-FEM1B (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

FEM1B [fem-1 homolog b (C. elegans)] gene encodes a protein which is a homolog of feminization-1 (FEM-1), a protein involved in the sex-determination pathway of the nematode Caenorhabditis elegans. It stimulates ubiquitylation of Gli1 as well as inhibits its transcriptional activity. It is a proapoptotic protein that facilitates proteasome inhibitor-induced apoptosis of human colon cancer cells. Additionally, FEM1B serves as an adapter or mediator protein that links CHK1 and Rad9 and facilitates checkpoint signaling induced by replication stress.

Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

69 kDa

rat, dog, horse, human, bovine, guinea pig

0.5 mg - 1 mg/mL

western blot: suitable

NP_056137

Q9UK73

wet ice

−20℃

human ... FEM1B(10116)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3