Anti-ESRRG antibody produced in rabbit

NA.41

ESRRG (or ERRgamma) is a transcriptional activator of Dnmt1 expression in humans and mice. This transcription factor has also been implicated in renal papilla development, as well as in lipid and lipoprotein metabolism.
Rabbit ESRRG antibody recognizes bovine, human, mouse, rat, zebrafish, canine, and chicken ESRRG.

Synthetic peptide directed towards the middle region of human ESRRG

Rabbit ESRRG antibody has been used for co-immunoprecipitation and western blot assays. Sigma has verified the use of the product in western blot (0.5μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissue sections) applications.

ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

51 kDa

rabbit, bovine, rat, dog, guinea pig, human, horse, mouse

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001127757

P62508

wet ice

−20℃

human ... ESRRG(2104)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3