Anti-ENPEP antibody produced in rabbit

HPA005128    Human Protein Atlas characterization data

ENPEP gene encodes the protein aminopeptidase A (APA), which is a membrane-bound ectopeptidase belonging to the zinc metalloprotease family. APA is expressed in a wide range of tissues, including the brain. Human ENPEP is localised to the chromosomal region 4q25. Human APA expressed in kidney is called gp160 and has a molecular weight of 160kDa.

Glutamyl aminopeptidase recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

APA (aminopeptidase A) that is encoded by ENPEP gene cleaves acidic residues, such as aspartate and glutamate, from the N- terminal of its substrates and its activity is modulated by calcium levels. It is one of the key enzymes in the central renin-angiotensin system, and regulates hypertension. It converts angiotensin II to angiotensin III by cleaving the N-terminal aspartate residue. gp160 plays a key role in the development of kidney, and therefore is also known as the human kidney differentiation antigen. APA activity has been shown to be decreased in various renal cell carcinomas as compared to normal renal cells. This might lead to an increase in the level of angiotensin II in renal carcinomas, hence contributing to angiogenesis. It has been suggested that the formation of Amyloid β peptides is facilitated by APA, where it truncates the full length Amyloid β at the N-terminal.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST85167.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunohistochemistry: 1:500- 1:1000

SHLPSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVE

Q07075

wet ice

−20℃

human ... ENPEP(2028)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)