Anti-DHRS3 antibody produced in rabbit

HPA010844    Human Protein Atlas characterization data

DHRS3 (dehydrogenase/reductase member 3) is an all-trans-retinol dehydrogenase, which belongs to short-chain dehydrogenase/reductase (SDR) family. This gene is localized to human chromosome 1p35.1.7 and is widely expressed in multiple adult and fetal tissues. However, it is predominantly expressed in cone photoreceptors. The mRNA for DHRS3 is absent in brain. DHRS3 contains the motifs characteristic of SDR family such as, YXXXK motif, the catalytic Ser-175 residue, the serine residue before Ly-192 which is highly conserved, TGXXXGXG motif which is a nucleotide binding motif and is highly conserved.

Short-chain dehydrogenase/reductase 3 recombinant protein epitope signature tag (PrEST)

Anti-DHRS3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

DHRS3 (dehydrogenase/reductase member 3) has a supposed role in the metabolism of retinoid and lipid. In cone photoreceptors, it regulates the conversion of retinal to retinol in the visual cycle. However, its wide expression in multiple human tissues, suggest that DHRS3 might play a general part in the metabolism of retinol. It acts as an all-trans-retinaldehyde-specific reductase, and becomes completely active only after activation by retinol dehydrogenase 10 (RDH10). It thus, reduces the rate of retinoic acid synthesis, by converting retinal back to retinol. In neuroblastoma (NB) cells which show overexpression of MYCN (v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog), DHRS3 is usually deleted, which leads to compromised sensitivity of NB cells to retinol. Thus, DHRS3 might be responsible for tumorigenesis of NB and its progression. It is suggested that DHRS3 also plays a role in developmental processes and tumor suppression via p53 and p63 pathway.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72127.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human, rat, mouse

antibody small pack of 25 μL

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPG

O75911

wet ice

−20℃

human ... DHRS3(9249)

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)