Anti-CDH22 antibody produced in rabbit

NA.41

Cadherin 22, type 2 (CDH22) belongs to cadherin family. Cadherins are transmembrane proteins. They contain an extracellular domain responsible for cell-cell binding, a transmembrane domain and a cytoplasmic domain.

Synthetic peptide directed towards the N terminal region of human CDH22

Anti-CDH22 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Cadherin 22, type 2 (CDH22) is a calcium-dependent cell adhesion protein expressed highly in the brain. Functions of CDH22 include morphogenesis in neural and non-neural cells during the development of brain and the neuroendocrine organs. CDH22 interacts directly with PRL3 (Protein-tyrosine phosphatase of regenerating liver 3), gene responsible for promotion of epithelial mesenchymal transition. PRL3 results in down-regulation of CDH22 expression. CDH22 is up-regulated in colorectal cancer and lymphatic metastasis of colorectal carcinoma. Absence of CDH22 partially suppresses proliferation of colorectal cancer cells.

Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

73 kDa

mouse, human, rat, dog, guinea pig, horse, rabbit, bovine

0.5 mg - 1 mg/mL

western blot: suitable

NP_067071

Q9UJ99

wet ice

−20℃

human ... CDH22(64405)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3