Anti-CDCA5 antibody produced in mouse

NA.41

CDCA5 (cell division cycle associated 5) gene is mapped to human chromosome 11q13.1. The gene codes for the protein sororin. The protein is localized in the nucleus. It is known to be conserved among the vertebrates.

CDCA5 (NP_542399.1, 1 a.a. ~ 252 a.a) full-length human protein.

Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE

Sororin regulates proper cohesion and separation of sister chromatids during replication, by stabilizing cohesin on DNA. Phosphorylation of sororin by cyclin B during mitosis, reduces its potential to prevent Wap1 (cohesin release factor) and Pds5 (cohesin-interacting protein) binding.

Solution in phosphate buffered saline, pH 7.4

mouse

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

human

indirect immunofluorescence: suitable
western blot: 1 μg/mL

Q96FF9

dry ice

−20℃

human ... CDCA5(113130)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids